PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 434aa    MW: 47161.8 Da    PI: 10.3023
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0212genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63.2e-14347394552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+ e +
  Gh_A12G0212 347 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEINEELQKKQEII 394
                  79***************************************9987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-14343413IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588345396IPR004827Basic-leucine zipper domain
CDDcd147073.90E-25347392No hitNo description
PfamPF001701.3E-12347395IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.16E-11347399No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-14347397No hitNo description
PROSITE patternPS000360350365IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGSHLNFKNF GDAPSMEGNE SKPLGNFPLT RQSSIYSLTF DELQNTFGGI GKDFGSMNMD  60
ELLKNISTAE ETQAFMTASV PGGEGSLSGG NLQRQGSLTL PRTLSQKTVD EVWRNLMKEN  120
DGAKDGSSGG GGGGANLPQR QRTLGEMTLE EFLVKAGVVR EDMQQFGVPN NTGFFGNNNS  180
GVALGFQQTN RNNGFLSNNN SVLSQPPRLP QNMTGTKSSQ PQQQQQQQQQ PPQQQQQQPQ  240
ARPLFPKQQT VAFAPSMHLM NTTQLASPGG RSSMVGIGDP SMNSNIVQSS GLQSGGMGIV  300
GIGSPGSQIS SDVISKNSVD TSSLSPVPYV FGRGRKCSAA LEKVVERRQR RMIKNRESAA  360
RSRARKQAYT LELEAEVAKL KEINEELQKK QEIINNTNFL VLCNAQFKQT LEAVNRAWGG  420
GKRQCLRRTL TGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.202440.0boll| leaf
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5274841e-132HQ527484.1 Gossypium herbaceum clone NBRI_E_EYT27PB03G3LVN simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436192.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q31e-120AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0B0N1780.0A0A0B0N178_G
STRINGVIT_03s0063g00310.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.13e-91abscisic acid responsive element-binding factor 1